SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR002150-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR002150-PA
Domain Number 1 Region: 4-77,306-506
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.9e-68
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00000639
Further Details:      
 
Domain Number 2 Region: 75-305
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 4.45e-68
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR002150-PA
Sequence length 509
Comment pep:novel scaffold:Smar1:JH431040:18973:25292:1 gene:SMAR002150 transcript:SMAR002150-RA description:""
Sequence
MSTKVCLIVIDGWGISDKKEGNAILNANTPVMDALSNAPGQHVTLDASGLSVGLPAGLMG
NSEVGHTNIGAGRVDIVQIHMSVENKEIYQNKTFVDACTRAKAGTGRLHLAGLVSDGGVH
SHINHLFALLEGAKLHQVPKTFVQFFGDGRDTNPVTTVNYTKQVLDHLKKNNYGQLAFIT
GRYYAMDRDNRWERIKIAYDGMVSGVGEKTTADGVINLIESRYSAPGDKRQTDEFLTPII
CCEDGLIKDGDTIVFINFRADRMREIAETFGIKRNFEPVKTANNLGIFCMTEYKADFPFP
LLFPPSQPTNVLGEWLSKQGLPQFHTAETEKYAHVTFFFNGGREEAFPMEDRLMVASPKV
ATYDLQPEMSCIQVALEMVRAISNGKYPFLLLNFAPPDMVGHTGKYDKAVIAVEATDKAV
GMVKEACDKHGYTLLVTADHGNAEVMIDEKGGPVTSHTTNRVPFLMTGPRKFKDLTHNPA
LCDVAPTVLDLMAIAKPDDMTGQSLLAPY
Download sequence
Identical sequences T1IME7
SMAR002150-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]