SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR004706-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR004706-PA
Domain Number 1 Region: 968-1064
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-23
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 2 Region: 233-333
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.45e-22
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 360-467
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.33e-20
Family FHA domain 0.0000531
Further Details:      
 
Domain Number 4 Region: 40-132
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-18
Family Ras-binding domain, RBD 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR004706-PA
Sequence length 2099
Comment pep:novel scaffold:Smar1:JH431523:45437:57827:1 gene:SMAR004706 transcript:SMAR004706-RA description:""
Sequence
MDPVRKVQERENLRNLIAQWNANRLDLFELSEPNDDLEFHGVMRFYFQDAGQKVATKCIR
VSSTATALVVIKTLIEKFRPDMRMLSIPKYALYEIHENGEERKLNDDEKPLLVQLNWHKD
DREGRFLLRRMDEKTYMTPQHFEDDVNFKRKLSKREKKEIKKREKLQRLKELEELDDEDP
EKKIAEKLYTELPETSFTRSISNPEAVMRRRRQQKLERKLQQFRSRDGGPDTGGTLKIYG
ESLCKDVPYKTLLLSVRDNAANVVKEMLNKYALDKLDSTHYCLVQSLNTTDIDSSGTSPG
KEYILDDDECPLSILMSYPPSKGSITFHIRRRPADYQPRKRKKKPKTGMEMDYRYDEVAE
KMPYFLELNPDGSEISNGVPHRHYLHFNVTEVGSERSISATGQFLQLFGPNVQPRHCVVA
HTDGIVTVTPCSRDSETYVNNQRVFETTILQHGMVLRFGKIHNFRFINSSRDDRRLRRDS
ASGSQNPIDYYDKHSMKDDSSLQASVLDNSFDVDNNVETVSTCSLKEESRREINDKMNKE
NKPPPPYERYEPRRQGHDPILPAVLEFREDKEDSFLRSVITSDSNIVQFKLAPTYTLYMA
ARFCASTHYRPDITPNERAVRLTGIMNKVASMIQHVIQEKNGVAIALAFWMGNASELLHF
LKQDRHLNPYTLDAQDVLAESVQVAFRSLSHCLQTDIQGIMPEFLDPRDDSNDEEGITGE
VLSVLSSAMSLLRRCRVNAALTIQLFSQLFHFVNMWLFNQLVGDSPANFCTRAWGARLKR
RLARVELWAEKQGLELAADCHLSRIAQAAHLLQSAKSTPADIANISSVCFKLNSLQLRVL
LENYQPMKDEAHIPLELVDNVVRVAENTADELARTDGRDVRLEEDPDLQLPFLLPEDGYS
CDIVRGVPAGLQEFLYPLQQTGLCRLTIQPTSSGYWTIYMSESEVSRTNLRRTGSLGQHG
VVTDLSRIGREPEVASIKLQKSNNGMGLSIVAAKGVGQDKQGIYVKSVVKGGAAEADGRL
QAGDQLLKVDGQSLVGISQEKAAEYMTRTGPLVTLEVAKQGAIFHGLATLLNQPSPVMQR
AWSKQPGPQQPLNSKPEWNRTLPKASQQVPYCQSTPSLNHSSMDEVNSSLNAVGRCHFLS
PCHGLPVNNASSLVPCCVKTSVSPICCCCCKSRGGGMCHATSSESFSRFCRISSCDALCA
ELNTCDDALRKWDSVTNFNPSAHAYKYCITPPRPPRNGNKSVPGGGFANSSSRRLSERDL
PSRVSREQAPDLDPGHGPRIQSSKSFPSLNVQEPLRSPTGVGKPPNEVFNPGYSRESSTA
SVNKEGMVRAPPQILVNGPQQQPRSRPPSQPNLQQQEERFYQNISLYQQSPPTGPKFQEN
MQQPLPSPKINPQRFNEYPQHVDPYQNQQMKLAYNGYGQVDPRNLRGSQSSLHRPEMVPN
VRERPLSAIVSQREREQFMNAVPQSGKGTEEYPVPYHRSEQHIRNDPRSVEMMRNAAAMN
GGYFPQVEQRREGFGNPEMRKSERDLIRQEAKMEEMREEVRRREERNREMQARGFQNAHG
KAPPPGYYPQQQFQRPPLVKPGPGGPASPIYNQEAQQYPPHLYQGQKPPPPITPKPKVSY
IQGPEKPQRHYMQPDNQEVPPERPPLPDEAHLYMESPPPPPPPASTHPLNQNGPNVSYRY
GPTGYPPAEQQYAAPPRSPGVHDPRFFARSPQNRVTFDPRLPQEGKNFGSNSDVATALSP
SPWEREEREKERKRRLTDARRMRDQEIQELEMMQYRSAKQEERLRTLRLEQEFQRRAEEQ
KNENDDDEENDDDDDLMERRGLLRMVQEDIERNRLRRLEQQSKDGEKQQQMKSVARMEYQ
QGTLPKQPPPDEWLKRQLEIKNHRRDQREEEERQIQQKLMEEEMMRQQKLEEVRKKKEQE
RAAQRELQAAREAEERLLREAQRRQPAATQRLDNLVMPNQGNQQQQNEILPPKRVSFHEP
KHDDTNDYDEHNDIHPTSNNNDNVMLATPSNSQQMNSYSSTGISPGVIGAQEVYRDPRMK
KMEAQRLNTQQPKGPGPEKLSFKEKMKMFALETGESNSPKDKVKISRAQREIETNLNGN
Download sequence
Identical sequences T1IU86
SMAR004706-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]