SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR006894-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR006894-PA
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 9.16e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00023
Further Details:      
 
Domain Number 2 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.42e-17
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR006894-PA
Sequence length 103
Comment pep:novel scaffold:Smar1:JH431732:233099:234886:1 gene:SMAR006894 transcript:SMAR006894-RA description:""
Sequence
MSYQLYRNTTLGNTLQETLDEFIQSGHISAQLAIKVLLQFDKAINNALATRVKTKLNFKA
NHLKTYRFCDNVWTFVLNGVDFTQMQELTKLDKVKIVACDGKA
Download sequence
Identical sequences T1J055
SMAR006894-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]