SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR007772-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR007772-PA
Domain Number 1 Region: 80-145
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 2.35e-22
Family Cyanase C-terminal domain 0.00023
Further Details:      
 
Domain Number 2 Region: 3-74
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000131
Family Cyanase N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR007772-PA
Sequence length 145
Comment pep:novel scaffold:Smar1:JH431806:105978:106415:-1 gene:SMAR007772 transcript:SMAR007772-RA description:""
Sequence
MERDNLNQRLIQAKRNSGLKWSDIAEAIGRSPGWTISALFGQHDVTVKEAQSLGSLLKLT
AEETEMLCRPAVRGASAPLNDPLIHRLHEMFNVNGAAIKQLIMEEFGDGVVSAIDFKFHV
KRVPHPDGDRAQITLDGKFLPFTPW
Download sequence
Identical sequences T1J2H9
SMAR007772-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]