SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR013885-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR013885-PA
Domain Number 1 Region: 8-81
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-28
Family FKBP immunophilin/proline isomerase 0.00036
Further Details:      
 
Domain Number 2 Region: 84-148
Classification Level Classification E-value
Superfamily EF-hand 0.000000000664
Family Calmodulin-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR013885-PA
Sequence length 156
Comment pep:novel scaffold:Smar1:JH431865:249158:251141:-1 gene:SMAR013885 transcript:SMAR013885-RA description:""
Sequence
MMVSMVLSGRDREEPFTFQLGHGHVIAGWDQGLDDMCVGEKRKLFVPSHLAYGDRGAGEK
IPPNAALVFEVELVSIGDPVPPVNVFKQIDANSDELLSREEVSDYLGKQVPEEMKEDGKQ
PFDQDQLVEEIFSHEDKDKNGFISKDEFGGPKHDEF
Download sequence
Identical sequences T1JJ55
SMAR013885-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]