SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR002463-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR002463-PA
Domain Number 1 Region: 366-553
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.54e-48
Family Nucleotide and nucleoside kinases 0.00000026
Further Details:      
 
Domain Number 2 Region: 222-355
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-35
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 153-243
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-20
Family PDZ domain 0.0000317
Further Details:      
 
Domain Number 4 Region: 70-120
Classification Level Classification E-value
Superfamily L27 domain 0.00000000033
Family L27 domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR002463-PA
Sequence length 557
Comment pep:novel scaffold:Smar1:JH431152:125115:156494:-1 gene:SMAR002463 transcript:SMAR002463-RA description:""
Sequence
MAAVGVGVGSGRAARDKGLGLAANIFRYQFKLKIYLIVSSFSGANTPRELYDRINTKTHT
PIKNQPTDGLQKAKEVLESLKEFEEETLEEVEELRLILNKPHLRALLQAHDVVAHEVYGE
DAIRITPPPVTPYLNGGDGYDSPNGGVDMDNVTRVRLVQFQKNTDEPMGITLKMNEEGRC
IVARIMHGGMIHRQATLHVGDEIREINGISVANQSVENLQRMLRDARGSVTFKIVPSYRS
APPPCEIFVRAQFDYDPKDDDLIPCTQAGITFHTGDILQIISKDDHNWWQARKESCDTTA
GLIPSPELQEWRTAYMAMERSKREQVNCSIFGRKKKQYRDKYLAKHNAVFDQLDLVTYEE
VVKLHSFQRRTLVLLGAHGVGRRHIKNTLITSHPDKYAYPIPHTTRLPKKDEENGKNYFF
VSHDEMMADIAANEYLEYGTHEDAMYGTKLETIRKIHQEGKMAILDVEPQALKVLRTAEF
SPFVVFIAAPTLTGMVGDFDGSLERLAKESDLLRQAYGHFFDLTIVNNDIEETIQLLECA
IEKIGTTPQWVPVSWVY
Download sequence
Identical sequences T1IN86
SMAR002463-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]