SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR003453-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR003453-PA
Domain Number 1 Region: 21-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.3e-41
Family G proteins 0.0000179
Further Details:      
 
Domain Number 2 Region: 200-238
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000981
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR003453-PA
Sequence length 280
Comment pep:novel scaffold:Smar1:JH431322:24113:27256:1 gene:SMAR003453 transcript:SMAR003453-RA description:""
Sequence
MCSMIASAATNSHPRSSPVKSYDYLLKFLLVGDSDVGKQEILSGLEDGASESPFCSTNGI
DFKTTTILLDGKRVKLHLWDTSGQGRFCTIIRSYSRGAQGILLVYDITNKWSFDGIDRWL
REVEEHAPGVPKILIGNRLHLAFKRQVSEVIADSYASKNDMVLYEVSPLCNYNIVESFTE
LSRLALRRNGMERLWRSNKVLSLQELCCRTIVARTTVYGLEQLPLPAAMKNHLKSYSLTS
CKPRLRQGHTHQQEKNIKKTKIIHPCDSPTLNCRKSCVLS
Download sequence
Identical sequences T1IQX4
SMAR003453-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]