SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR004192-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR004192-PA
Domain Number 1 Region: 284-467
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-43
Family cAMP-binding domain 0.00032
Further Details:      
 
Domain Number 2 Region: 114-268
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000224
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR004192-PA
Sequence length 624
Comment pep:novel scaffold:Smar1:JH431448:8474:14766:-1 gene:SMAR004192 transcript:SMAR004192-RA description:""
Sequence
MHDSRSERLKNQMVQRKIKGLVKALSARTERAKEMIVRPITPDPFESPVHDKEDARDDPD
NKELNFRSRENSIFEKNAPFDLTSRMSTPFSLSGPMSVKMSKCLLWVQRPLNSQGWFYMS
WQFLVLICFCYNSVGILLRVVFPYQTPTNLKYWLLADYTADAFYFADILLKLRVKLIVKG
LIVSELAEIPIHYVKSTPFVIQVFWDFFNKWDRKAKNPYIVSYVRCYLFAVKAATSIGKN
PKPIEQNEYLFMTFSWLAGVFIFAILIGQNVVIKDILSLASQVKQDYRQRIDRVHAYMHH
MNIPLELQDRINTWFEYNWQENKGIDEEIILNQLPKKMKSDLALYIHFNTLKKVQLFRGL
ETELLKELVLKLKPMLFLPGDYICKKGDVGTEMYIFLGGPKGDVVLATLGEGSVFGEVSL
LALAGGNRRNADVRSKGYSDMFVLDKRCLQDAVREFPGAEEILHHKARKLMNVNHQKGAQ
EEIKNCEILNTAVIENPKRAPQMAETVLRVIMSQSAASLKQTKKIDLPADVAMLSNEDSS
ANNIGSQFFSLEEINEAIDNEGYSSCSSSTLSLVSCSSDEERGVDEMEIAKYEQIKKIIS
HSSLIGTSNRSHTDLKNPFNDKNI
Download sequence
Identical sequences T1ISV5
SMAR004192-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]