SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR004902-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR004902-PA
Domain Number 1 Region: 281-621
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.75e-43
Family Quinoprotein alcohol dehydrogenase-like 0.0055
Further Details:      
 
Domain Number 2 Region: 29-166
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.32e-25
Family Acetyl-CoA synthetase-like 0.0012
Further Details:      
 
Domain Number 3 Region: 157-208
Classification Level Classification E-value
Superfamily ACP-like 0.00000267
Family Peptidyl carrier domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR004902-PA
Sequence length 626
Comment pep:novel scaffold:Smar1:JH431554:9476:21579:-1 gene:SMAR004902 transcript:SMAR004902-RA description:""
Sequence
MIFIGGRERVCFIDDEEDSILRLMPVFRETGDLVRIEADGEMYFVHRRDSQVKRNGRKVS
LAAIEEAVLSYNGVETSAAVFDVETQQIYLFIILKNISEMSPKLKMELDQHLHLKLPSNA
IPNTIQQISSLPLTKHGKINSKRLLKLVQNRQSKPESVRTYIEQEWKRLLNVQKIESHDN
FISCGGDSIRIIHFAEDLSALTEHPLPQLVDLLLNDTFAVVSAYIDEITTANETVPIKKD
LKMDISSDVGDRTRKIVERDDKLIFSKRGGEETIDLPGDFALKLGWRFDLRKCVDASALM
VGSTDNSKVRVFIGSHSNEFAAIDVETGEAVWVVRLGGRIESSACVSLCGTLVIVGCYDN
FIYCLFGHDGEINWKFQTGSQVKCSPIIDPHSGHVLVGSHDHYLYCIDVKFGTCIWKISP
THGSIFASPSVSKQPHCIYIGTLDGKLCSLNPSNGLVFWEKNLQKPIFASPVVTNDKVFA
ANVNGDLYCFSHIGKQIWLFSTIGSIFSSPIVIHKKFLMFGCHDSKLYCVLVETGHVHWI
LQMNSPIYASPFSLFNCSKERSGHVGVIACITGEIKLVSVINGSEIASYTLSGEIFSSPV
ILKDKLVIGCRDNFVYCFDFGSQSTT
Download sequence
Identical sequences T1IUS3
SMAR004902-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]