SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR006402-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR006402-PA
Domain Number 1 Region: 205-457
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000137
Family Tropomyosin 0.0019
Further Details:      
 
Domain Number 2 Region: 465-721
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000262
Family Tropomyosin 0.0017
Further Details:      
 
Weak hits

Sequence:  SMAR006402-PA
Domain Number - Region: 1589-1751
Classification Level Classification E-value
Superfamily Tropomyosin 0.000589
Family Tropomyosin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR006402-PA
Sequence length 1827
Comment pep:novel scaffold:Smar1:AFFK01020350:25801:38450:-1 gene:SMAR006402 transcript:SMAR006402-RA description:""
Sequence
MPSSRIAVSNPHSSAPLYSNPGRNFNWVESARKQATLIHQLEDELRSHHLRNPDLGLQQQ
LEQLYAEKQHQAKEIYLLRETIKEMELRIETQKQTLQAREESIKKLLEMLQTKGAGGKLQ
EDERLEYERMKTQLIEAHARARHLESLVESKDKDFLKTKEDARIFTLERELALMETEMKR
WHSVRELRSRLVNCDDWKMTEVLLNTEKQNKIKIEEARIEVQKRDQEILAMGAKMRTLEE
QHQDYQRHIAVLKESLCAKEEHYNMLQTDVEELRQRLEEKNKLIEKKTQQALQAQQERNR
LNSELNELKDHMDIKDRKINVLQRKIENLEDLLKEKDNQVDMARARLTAMQASHSTSEGA
LTSLEEAISDKEKQISQLREQRDRAEQEKLEERELHERELTEYKMKLHAMESEIEKLQVR
LEKNQAEKDKLEAKLENSQSELGKSKAEVDKIHSEMGRSSSDWESAKHEISHYRIENDRL
RAECDRLKTDVDRTQMSYGKTQFTQSHEVERIQEKLDKSQGDLRRAQAELRMNQSEYDRV
HVEVEQLQEKVEKSQGEIYRLKAKLENAQSEKDSLQEELDRSQTALGRSHGEKEKSQMEL
DKVRDELERNQSTLTKIQVNYEKTQVALDKAQTEVDRLQEKADKAQNELRKVQIDKEKSQ
YDLDNMQTQLDKSQGQTQRLQKEKETTFVEVDKLRDKLDKTQMQLSRVQKERESVQIDVD
KMQEKSDLLQAQLQKALRDKESSQTEQEVLRDRLEKAQSQLAKFQLEKETTIEDYIVMKD
KYDKVLVTQQRLQDERDQAKSESERALEKLERAQVDAYKVQSKLESLEKEHDRLLVDIDK
MQVLSSKAKDDQRRSQEELEKIQEMWDMGQVQLARSREAEEKSKVELDKLSAEMEVMRER
YDKVQVELRKAVTEKERLQAESDRLVGELDRTHSQYGKFHATQEKSQEELARMQVELAKV
YERLDKAQTETRRFMAEKEQAEREAVSAKGDLERFQTRMGRYQETQEKSASEVERARVDL
EKAKDKLEKAELEVDKVAMQKEKMQQELARLQAELERSEAARNKSRFEQEKILAEAERAK
IDVEVMREKYESCQNDLQRQVIIKDQLENDVHRLQVELEKANAQIRRFSMSQDKQLEEVE
RTHIEFEKVKDRLEKSQAETQKVIQQRDRLDTELRTLQKEMEMMRMDNAKTSSQQTDRLA
AEVERLRNRLQQATEELQLSNQARETLQTEMQRMATELEESKSYLNKQKDNTQASRGELD
RAAKEIDKLHSQLERLQMELQQVLKDRNIFQQEANKYKVEFEQSKSAIGKTHEFQQKSRA
ELDKSLSELQKVHSELEKVTLDLKNIKTERDHLVSQLEKSHEMLAGFQRQLEQSQSELHE
SHEDNKKLQNQMNKTQKELDRLQKETTRVDKTDTKADKENQRLKQHLEKAQQEIKNATTE
RERYQSQLEMLVQELERQQVELHDVKERASATKGKEGEVAHKQLDEKQKQLEERERLMNE
KNKQSEDKNKKLEERQKALEEMDKRLRRKKEKIDEMEAHMQKAEVGQNEALAKQIAELRK
RNQELEKENKEKEKEKGGGVDSARQQQETDRLLKLLSAAEDEKFTKDKQIQDLQTALNNV
KRSQQAGAHGMEDARKREEEARKETSKTQTHLKETQERVEVLEEALRESLRITTEREMTL
EDSLSARKSAEERIRKLEERHKSLQNANNLRCTNCPVVNERLNVIEQALTTLKAERRKAL
EELFDMKEALAAAVSEKDAHIALLEMSGVKNYKTAEEVDMLKAARKTIVDKMKTENEKRV
VMLRDWMDLGDNLVGEILIKVDQNGKS
Download sequence
Identical sequences T1IYT4
SMAR006402-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]