SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR007956-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR007956-PA
Domain Number 1 Region: 115-516
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.85e-112
Family Pyridoxal-dependent decarboxylase 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR007956-PA
Sequence length 561
Comment pep:novel scaffold:Smar1:JH431816:59256:65123:-1 gene:SMAR007956 transcript:SMAR007956-RA description:""
Sequence
MDLNMVNGNFTEWMKIAKFHIDEIRFSINDHFKSCEPLCVIASTTFITILVIWIWQFIFL
QEQSLWIRTRNKFFKLARKLPMVKTQLAKEIKKARKLMNDDVQKQNEGCSFLQILPDKGW
NKEEIIEKSKKSFMMGKVDWKKGKVSGAVYNYSDALNEITSLVYGMCAYTNPLHPDVFPG
VRKMEAEVVRMTCNLFHGDSNSCGVMTCGGTESIILACKAYRDRAFDIGIKHPEILVPVT
AHCAFDKAANLMRMKIKHVPVDPVTMKVDMKQYQRYITRNTCMLVGSAPQFPHGAIDPIE
DISKARLGLKYKIPVHVDACLGGFLIPFMEEAGFPVVRFDFRLPAVTSISADTHKYGSAP
KGSSVLMYRDESYRHYQFFVQPNWPGGIYASPSLPGSRAGGIIAACWAAMTFFGRDGYVK
NCKKIIETANRIEKGLREMPDLKIIGKPEVSVIAFGSDKFNIYRLSDALHKRGWSLNALQ
FPSCIHLCVTFMHTADGVAEAFLNEVRDCTEIIMKDPTADAVGKAAIYGLSQTIPDRNIV
SELAWTFLDSCYITSFDPETE
Download sequence
Identical sequences T1J300
SMAR007956-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]