SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR013138-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR013138-PA
Domain Number 1 Region: 365-566
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.6e-53
Family Nucleotide and nucleoside kinases 0.00012
Further Details:      
 
Domain Number 2 Region: 204-330
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-26
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 128-214
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-21
Family PDZ domain 0.0007
Further Details:      
 
Domain Number 4 Region: 67-117
Classification Level Classification E-value
Superfamily L27 domain 0.00000000789
Family L27 domain 0.0055
Further Details:      
 
Weak hits

Sequence:  SMAR013138-PA
Domain Number - Region: 6-55
Classification Level Classification E-value
Superfamily L27 domain 0.000283
Family L27 domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR013138-PA
Sequence length 570
Comment pep:novel scaffold:Smar1:JH432215:104610:107450:-1 gene:SMAR013138 transcript:SMAR013138-RA description:""
Sequence
MPNGSGEPTVQRLLATLDQVRYKVNGSEDDYQFLRDLLANSKFRALLLVHDRINQNGKEP
KQPATTNAFHINEEVLDLAHKSKLREFKELFQILSSSHMKSLLLAHDQIASKDYYPKLPE
IPREVDEDEETVKIVQLVKSNEPLGATIKHDDNSGTVVIARIMHGGAADRSGLIHEGDEV
HEVNGINVRGKTPNDVLHILDESIDGTITFKLIPAEERAHSRESKVRVRAAFDFDPRKDL
DIPCREAGLPFHKGEVMHIVNQDDPNWWQARKEGDRNVRAGLIPGRLLQERRILNARNEL
NDDDEVPLCSFTALSSGRSPLMTPRRTKGTKKIMYDAMEKEDFDREEIATYEEVARYYPR
PGIYRPIILIGPPGVGRNELKRRLLAIEPDHFKTTIPHTSRPAKPSEVDGKEYYFVSREV
LEEEIRKGRFVEHGEYKGNLYGTSLETVKSIVNAGYVCVMNPHPQALKLLRTAELKPLII
FIKPPPFEQLKETRHNFHARSTFDESCSRGFSDEEFHDITNSANRIDYLYGHLFDFEIIN
EDLMTAFDELYCTMHQIEMEPQWVPASWVQ
Download sequence
Identical sequences T1JH09
SMAR013138-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]