SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SMAR014361-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR014361-PA
Domain Number 1 Region: 382-520,555-608
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.04e-55
Family Nucleotide and nucleoside kinases 0.0000472
Further Details:      
 
Domain Number 2 Region: 260-369
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-26
Family SH3-domain 0.00093
Further Details:      
 
Domain Number 3 Region: 132-231
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-17
Family PDZ domain 0.00048
Further Details:      
 
Domain Number 4 Region: 76-124
Classification Level Classification E-value
Superfamily L27 domain 0.00000000388
Family L27 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR014361-PA
Sequence length 612
Comment pep:novel scaffold:Smar1:JH432122:133862:138234:1 gene:SMAR014361 transcript:SMAR014361-RA description:""
Sequence
MVVKREGSANRPVKEKAAFQHVQENIDELNGRSGFQDTDLIFLKGLMNSPIMKSLVKVQD
SLEGKNGSLEPVGTGNVDLVKEIASTCRKSRNRDATELSRLLQNAHVKALLDAHDTIAGK
AYVPPQESQSTLLPPLNGMPTDAIRMVGLRKSSHEPLGVTVKMENSELIIARIMGGGMID
RQGLLHVGDIIKEVNGIEVYTPEQLQEEIKKAEGTVNLKIIPSYSDYPVIPQDLPRRQGS
PIPTTPREGRKLTVFTDNLPTLPCYVKALFNYDPKKDTLLPCTDIGLPFKQGEVLQILNT
QDPNWWQAKKIGPSPQTGLIPSQELEERRKAFVRPEFDYVTKTSMCGTKVSKKKKKQMYH
SRSNTEFDKAELILYEEVARMPPFQRKSLVLIGPPGVGRRTLKNRLIAHNPELFGTVVPH
TSRPAKDGEDEGRSYMFSSQEDMEDDINENKYLEFGTYNGYLYGTKLDSIRNVIRSGKMC
ILDCNPQGLKLLNTPEFMPFVVFLSTPSIETLRQLTDNKTPDSIGSRNFTFDRAIMGRQS
RRARTLESLSSIVEEDDMRKKVDESARLQRAFEKYFDVIIMNEDMDRTFEKLLKAVNALS
TEPQWVPVSWVY
Download sequence
Identical sequences T1JKI1
SMAR014361-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]