SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|47458836|ref|YP_015698.1| from Mycoplasma mobile 163K

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47458836|ref|YP_015698.1|
Domain Number 1 Region: 120-335
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-30
Family Extended AAA-ATPase domain 0.00016
Further Details:      
 
Domain Number 2 Region: 362-460
Classification Level Classification E-value
Superfamily TrpR-like 2.43e-27
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|47458836|ref|YP_015698.1|
Sequence length 462
Comment chromosomal replication initiation protein [Mycoplasma mobile 163K]
Sequence
MKKEIFDNKYDYYLKTKNLIDYIDSAINDEMLMKNFFSNLEIEKVNDNEVFIKFGNEKIT
NFIKENYFYIIKDGIKQIFLRDLNVIYLTKQDKKTNFDSDDINKIDKIINKKTNFENFIN
KKFTFENLVECDFNKDVLRAIKNVYKQEEIIFNPIFIHSNSGLGKTHLLHALGNEILKES
NKSVVYINPDLITQKMVFLMQKGNNEELENLKSFYKNADVLLFDDVQNYKNKEVILKIVF
DIINNSLEQQKQIVICSDKKPDELGGFEQRFITRFKSGLTLGMKKASINDLKTILKFLVI
KEKLNPDKWEEESYEFVAKNHSNSIRDLIGALNKVKFYSNDFAKNTPYSYLVLKNIFSDL
KLDKNNINEDKIISIVTKYYKISKSDLISKSRIPNIVLARDITMWLIRNVLELTFEKIGE
IFNNRTHSAVITSINRINQKLINDANLKNILGEIENKINNFE
Download sequence
Identical sequences Q6KIT7
267748.MMOB0010 WP_011264521.1.31918 gi|47458836|ref|YP_015698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]