SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108757642|ref|YP_633093.1| from Myxococcus xanthus DK 1622

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108757642|ref|YP_633093.1|
Domain Number 1 Region: 282-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000152
Family EGF-type module 0.045
Further Details:      
 
Weak hits

Sequence:  gi|108757642|ref|YP_633093.1|
Domain Number - Region: 329-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00369
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|108757642|ref|YP_633093.1|
Sequence length 399
Comment EGF domain-containing protein [Myxococcus xanthus DK 1622]
Sequence
MLSNGTRVLDSKCVPLKLKMEFMRSLLWRLSGVTVLTSDRHPQVEADWSKTMKVSRVAPM
WRMLSAALAFGMMSACGSELEDESVVSEEAPVGGESSSDSASAMAGDRYANAVVQSGVIA
VLNPNNAVGAPDGNAATFLGLLGGSMVLDMGLGEEGTGPLRVYYQGLSLAVIAQVEFLRG
DMSIISTGQANLLDLGLGTHSTLVPFSSSTPYRYVRLRGGVASLYGLDAVEDTGGGASAV
CGDGRINNGEQCDDGNRVSSDGCSSTCRVEPGYTCNGMQPSVCTDVNECTNGTAQCSVNA
ICTNTPGSYTCTCRPGYWGNGWTCSDIDECSNGTAACNPSQVCVNTPGGYECVGGSCPAP
RVQCGAQCVDVSSDVNNCGACGVVCPAAKTCSSGVCVMR
Download sequence
Identical sequences Q1D2N0
WP_011554915.1.75941 WP_011554915.1.91991 gi|108757642|ref|YP_633093.1| 246197.MXAN_4937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]