SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108758285|ref|YP_631138.1| from Myxococcus xanthus DK 1622

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108758285|ref|YP_631138.1|
Domain Number 1 Region: 200-481,558-589
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.21e-96
Family Type II chitinase 0.000000891
Further Details:      
 
Domain Number 2 Region: 43-85
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000000000379
Family Carbohydrate binding domain 0.00094
Further Details:      
 
Domain Number 3 Region: 481-557
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000000516
Family Chitinase insertion domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108758285|ref|YP_631138.1|
Sequence length 599
Comment glycosyl hydrolase [Myxococcus xanthus DK 1622]
Sequence
MRRSWWASGLIATALSVAGCDSEVPSSHVRDMTAFQDAALAAEWAAGVAYSVGTRVTYQG
RLYECRQPHTSQADWTPVAVASLWLDLGPAGGGEPDAGSGGTDAGTGGDVTAPTVGLSAS
ASRIIAVGPLSLTATATDDVGVTRVEILENGAVVATGSQFSRAFSGWEQNGTYVYAVRAY
DAAGNVGTTTLTVVVEIPGGPPPGGKRIVGYFTAWGIYARNYHVSNVQPSKLTHINYAFS
NISGDGRCILGDPFADIDKSGGWQGEWDPGQLRGNFRAFKEMKRQNPHLKLLISVGGWSW
STHFSTVASSPASRAAFVKSCVDLYIRGQYPGVDPVNGEGVFDGIDIDWEYPVGGGLPGN
SNSPADKQNYTLLMQEFRSQLNAVTTQTGKPYLLTIATGASPDLLENKQETKKLSDVLDW
INVMSYDYHGAFESTVNFHSALHRVTGDPGAATGFYTDGSVSKMLALGVPPAKIVVGVPF
YGRGWGSVPNVNNGLFQSGVPTRGTWDDGSSGLTGVFDFKDIKANYERPGSGYTKFFHPE
AKEAYVYNPATGIWIGYDDVQSINAKADYILNKNLGGAMFWELSGDDGSLLDALARKLR
Download sequence
Identical sequences Q1D885
WP_011552987.1.71322 WP_011552987.1.72039 WP_011552987.1.75941 WP_011552987.1.91991 gi|108758285|ref|YP_631138.1| 246197.MXAN_2927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]