SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108759728|ref|YP_629882.1| from Myxococcus xanthus DK 1622

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108759728|ref|YP_629882.1|
Domain Number 1 Region: 58-292,361-392
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.96e-56
Family Type II chitinase 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|108759728|ref|YP_629882.1|
Domain Number - Region: 292-344
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000458
Family Chitinase insertion domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108759728|ref|YP_629882.1|
Sequence length 410
Comment chitinase [Myxococcus xanthus DK 1622]
Sequence
MTGSTNTAVTWSVQEGAAGGTVTPAGLYTAPAIAGTYHVVATSQADPTKSAVATVTVPNT
PPPPSGTWVSGYYTGWNADMYPPEKVDFSALTHILVGRVTPNPDGTVNTQFDNSNGPAIA
RTLSTRAHAAGRKAIIMVGGAGEHDGWVGAASNANRAQFVQNLLNAMDTFGYDGLDIDWE
PVEQVDKPALLALIQALRAARPQMLLTMPIGWVNSNFPEDADPWFTNLVPYLDQMNVMTY
EMTGPWGGWLSWYTSALTGEAGNHPTSVSSSLSAWANAGIPKNKLGMGIPFYGMAWRNIT
GPYQPYTDWSDYVGSDNSFTYSKILQLSATGVYHWDEAAKASYVTFDVPVEDGTVRWISY
DSPQTIAAKGAFAHDNGYGGTIIWTINQGCTDPQTGANPLLDAVKNAFLP
Download sequence
Identical sequences Q1DBU1
246197.MXAN_1630 gi|108759728|ref|YP_629882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]