SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108762764|ref|YP_634955.1| from Myxococcus xanthus DK 1622

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|108762764|ref|YP_634955.1|
Domain Number - Region: 38-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000587
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|108762764|ref|YP_634955.1|
Sequence length 215
Comment lipoprotein [Myxococcus xanthus DK 1622]
Sequence
MKHLMRPTLRVLFLTACAAAAVACGGDDDPAPIEPGDSCEPNGHIHREPSGDWCHCNKGY
VAADDGLACVPDPNHVPGDGFDFGDDGEHACWHVTNGPFVTVNATTARHPRVDDFHTYYT
VKLLPENSQYVGTFSYKAFATGNFVVYLSSPDVPVTLTETAISTTVPQAGAQATGGFCDG
LKHMVGYELTDRVQYTLQLGPTSLPELNMVIEHVQ
Download sequence
Identical sequences Q1CXB8
246197.MXAN_6838 gi|108762764|ref|YP_634955.1| WP_011556763.1.71322 WP_011556763.1.72039 WP_011556763.1.75941 WP_011556763.1.91991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]