SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108762781|ref|YP_633489.1| from Myxococcus xanthus DK 1622

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108762781|ref|YP_633489.1|
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.8e-19
Family Frataxin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|108762781|ref|YP_633489.1|
Sequence length 110
Comment frataxin family protein [Myxococcus xanthus DK 1622]
Sequence
MMDEARYNQLVSAAFKRILAAADTIDPDILEADSTGDMVTLTAASREKCIVNTQRAVRQI
WVAGQGQGIHFDYDAATGTWKDDKGRGLELMSFVADVVRGITGADFVYPG
Download sequence
Identical sequences Q1D1I4
WP_011555304.1.71322 WP_011555304.1.72039 WP_011555304.1.75941 WP_011555304.1.91991 246197.MXAN_5339 gi|108762781|ref|YP_633489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]