SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108763074|ref|YP_630509.1| from Myxococcus xanthus DK 1622

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108763074|ref|YP_630509.1|
Domain Number 1 Region: 178-422,494-523
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.12e-50
Family Type II chitinase 0.0006
Further Details:      
 
Domain Number 2 Region: 2-163
Classification Level Classification E-value
Superfamily Fibronectin type III 2.36e-25
Family Fibronectin type III 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|108763074|ref|YP_630509.1|
Domain Number - Region: 409-479
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0016
Family Chitinase insertion domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108763074|ref|YP_630509.1|
Sequence length 546
Comment glycosyl hydrolase [Myxococcus xanthus DK 1622]
Sequence
MTWLPPTSDGGHPVMYYIVRCEPACGGAIVTSDEFQATVRGLHNGFAYTFKVAAVNINGE
GPASVQSELVTPQPGLSIPNPTVPGQPRGVRATPGNGHAFVSWLAPASYGGRPLRQYRLT
AEPGGVSVMVDAPAASAVIPGLVNGVPYRITVAATNEKGEGPVAVANTIQPRAGGEPTEW
VTGYFVGYQLWMQPVDAVDLAGITHLVVGRVKPNPNGTLNANFDANIDDSHGRAMAKALA
TRAHQQGRKALLMLGGFGEHEHFVHAASEAQRAHFIRNIIQLMDELGYDGIDVDWEPIIL
AADIPEGAPMEPDDGEPLLALLEGLRAARPDIILTVPVDWLNSNFKMSRYRADFMKQLAS
RVDQLNIMSYKMSGHWGGWESWHSSPLYGHSQFHPTSVSHSVEGYLDAGVPAGRLGMGIG
FFGTCWGGVTEPNTPLDGREGVFEGQSDNFMSYTNIMTHYYRADASRWDDEAKVPYLSFP
TGHGPGLCNYVSYEDPRSISVKGQYAREKNLGGAIIWTISQGHFLQPTNGHRDPLLDAVK
HAFLDP
Download sequence
Identical sequences Q1DA14
246197.MXAN_2288 gi|108763074|ref|YP_630509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]