SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108763670|ref|YP_631956.1| from Myxococcus xanthus DK 1622

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108763670|ref|YP_631956.1|
Domain Number 1 Region: 71-107,185-283,619-671
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.33e-22
Family Prokaryotic proteases 0.057
Further Details:      
 
Domain Number 2 Region: 297-390
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000068
Family FCH domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|108763670|ref|YP_631956.1|
Sequence length 714
Comment hypothetical protein MXAN_3774 [Myxococcus xanthus DK 1622]
Sequence
MSFPQNRDTHGPGKDRFMKRLFVIATLLGAAPAMADEGMWTYNNFPSAKVKEKYGFEPSQ
QWLDNVRLSSARLAGGCSASFVSANGLVMTNHHCARGCIDQLSTAKKDYIANGFYAKAQG
EETQCPAMEINQLVKITDVTETLNKATQGLTGKKYADTLKAKMSELEQACSAGNAKARCD
VVTLYQGGQYNLYEYKRFQDVRLVMAPEHAIAFFGGDPDNFEFPRYDLDVTFLRVYEDGK
PATTNNFFKWSDKGAQEGELTFISGHPGRTSRGLTIAELEFQRDVVLPKTLMTLSEMRGM
LTEFGRRGAEQRRISTNLLFGVENSVKALKGRHEALLDKTFFAQKVAAEQDLRKKVEANP
EMKKKYAAAWDEIAKAQAQLRNIRQDLTFMENGGGLSSTLFQVARTLVRGAEEFPKANGE
RLREFNQANVPALEAQLFSPAPVYPELEIARLTFSLTKMREELGSDHPFVKKVLGKESPE
KLAARLVKGTKLRDVKARQALYKGGKAAIAASKDPMIQLAVALDPDMRAVRKSYEENVES
VIRKNSELVAKSKFEIYGTNQYPDATFSLRLSYGAVKGYSENGKQVSPITQMAGTFEHAT
GEEPFALPKSWLKNEKALDGTTPMNFVSTNDIIGGNSGSPVINKDAEIVGIVFDGNIQSL
GGEYGFDESVNRSVSVHSQAIIESLTKIYGATRLLEELRPGSTKVPPVKASPAK
Download sequence
Identical sequences Q1D5W7
gi|108763670|ref|YP_631956.1| WP_011553787.1.71322 WP_011553787.1.72039 WP_011553787.1.75941 WP_011553787.1.91991 246197.MXAN_3774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]