SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108757869|ref|YP_635421.1| from Myxococcus xanthus DK 1622

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108757869|ref|YP_635421.1|
Domain Number 1 Region: 40-395
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 5.23e-112
Family MLTA-like 0.00000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108757869|ref|YP_635421.1|
Sequence length 411
Comment transglycosylase [Myxococcus xanthus DK 1622]
Sequence
MDMRHLRILLLSALGLLASACPSPTRAPVTRPEDALIRLSRKMEPRDDGDVASLRTAVAE
SLVWLRSRPSDQRFIYGARQVSIAELRTALERLHARLREDLTPEALWALVLEDFEPLEAA
GGEDGQVLFTGYYEPTIEASLTRTDVYNVPIHGPPSDLIEVPLESFAERFKSERVFGRLD
GRKVVPYWSRGDIRGGRLSGRKLELAWAKDPVALFFLEVQGSGSLLLPDGSRRRIGYAAS
NGKPYRSIGSLLIQEGAIPKEEMSMQALRAWLAANPQQCHRVLDHNESYVFFRFLNTASV
GSLGRPVTAGRSIATDARLFPKGGLAFIHTERPVRMADGSVQWKPLSRFVLNQDTGGAIR
GAGRVDVFWGAGPQAELAAGMMKQKGRLLFLVPRPGRAAPLVAPVSVTPPK
Download sequence
Identical sequences Q1CW02
gi|108757869|ref|YP_635421.1| 246197.MXAN_7308 WP_011557227.1.71322 WP_011557227.1.72039 WP_011557227.1.75941 WP_011557227.1.91991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]