SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108757890|ref|YP_632163.1| from Myxococcus xanthus DK 1622

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108757890|ref|YP_632163.1|
Domain Number 1 Region: 84-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000106
Family NfeD domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108757890|ref|YP_632163.1|
Sequence length 160
Comment NfeD family protein [Myxococcus xanthus DK 1622]
Sequence
MDLTPTAWQLWLIAALLLGALELQLTSFMVLWLAVGALASSIGAALGLSLNGQLYLFTAV
SVALFAASRTLFKSVFMRDAAHLKTGIEAMLGQEAVVVESLGDPLGGTVRINGELWTARS
LSGPVPEGELVTVEQVEGLKLWVRRPTASLPVPSGDPRKE
Download sequence
Identical sequences Q1D5B0
gi|108757890|ref|YP_632163.1| 246197.MXAN_3983 WP_011553993.1.71322 WP_011553993.1.72039 WP_011553993.1.75941 WP_011553993.1.91991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]