SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108758172|ref|YP_634628.1| from Myxococcus xanthus DK 1622

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108758172|ref|YP_634628.1|
Domain Number 1 Region: 453-548
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000785
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108758172|ref|YP_634628.1|
Sequence length 629
Comment sulfate permease [Myxococcus xanthus DK 1622]
Sequence
MPTSATRSAASWLSRAVPFLESVRGYRATWLKRDTVGALTVTALLIPEGMAYAELAGLPP
TAAFYAAPAGLVLYALFGSSRQLIVAVSAAVAVLSAATVGALAQAGSPRFVVLTAALALM
AGLISLLAGVLRLGRIAQFFSASVLTGFVFGLALIIAIKQVPKLFGVKGGDGNFFERLWF
LVTHLGSTHLVTLLVGAGSLIMLLALDRVSKRLPAALVVLALSIVVTALLGLDARGVSVV
GKVQAGLVPPQVPDVGLGDLLRLLPGASGIALVAFAEAIGPARMLAARHGYEVDANRELV
GLGAANMGAGLFQGFSIGCSLSKSAANDAAGARTEVSAMLAAGFTLLVALFLTPLFRLLP
EATLGAIVVVAVSGMMDVREMRRLHRMRRADFLGALVALVGVLALDVLPGLLVAVGVSLF
LTVYRASVPRLSELGRVPGTLAFGDVRHAPRPLTVPGMLILRPNEGIFFANATALRDEVM
TRVRHAGPSLHAVLLDMEVTADLDVPGADMLAALHDDLARRRVTLMLTRVMAPTGRMLER
TGVTAKVGAEHLYAQVLDAVVEHLARASAATPEAQGLVRDGLRRLRMLVEEASTTLDADE
GADRERLQTLGRRLGRAESALGEERPGPH
Download sequence
Identical sequences Q1CY95
246197.MXAN_6505 gi|108758172|ref|YP_634628.1| WP_011556436.1.71322 WP_011556436.1.72039 WP_011556436.1.75941 WP_011556436.1.91991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]