SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|45357747|ref|NP_987304.1| from Methanococcus maripaludis S2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45357747|ref|NP_987304.1|
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 9.48e-39
Family CTP-dependent riboflavin kinase-like 0.0000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|45357747|ref|NP_987304.1|
Sequence length 127
Comment riboflavin kinase [Methanococcus maripaludis S2]
Sequence
MEIFGHVVSGLGEGKFFVGLTHYKNKFEELTGFTPFEGTLNVKLKHNFNLDEFNPIEFDG
FEIDGKKYFGGKVLLIKLFNKQGNSINCAVVAPKKTDHSKKTLEIIAPIQLRKFLLLKNS
DVVKLVI
Download sequence
Identical sequences Q6M0T4
WP_011170128.1.40991 gi|45357747|ref|NP_987304.1| 267377.MMP0184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]