SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45358362|ref|NP_987919.1| from Methanococcus maripaludis S2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45358362|ref|NP_987919.1|
Domain Number 1 Region: 5-82
Classification Level Classification E-value
Superfamily Homeodomain-like 3.59e-19
Family Tetracyclin repressor-like, N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 79-191
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000978
Family Tetracyclin repressor-like, C-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|45358362|ref|NP_987919.1|
Sequence length 192
Comment TetR family transcriptional regulator Member [Methanococcus maripaludis S2]
Sequence
MKANIEDKRKAIMDAALKLFTERGFHGTSTAQISKEAGVATGTLFHYFPTKEDLINNLYF
EVKADLSREMVKDLEPQVNFKDRLKKIWDNLVRWGLDNHNEFLFVGQFCNSPYISNFTRE
EVMKEYVFLHKLVDDGIKNEEVKELPSELVIAMFYQNSRTLVDVISACGPSCNENKFIDD
GFEIVWNGLVKN
Download sequence
Identical sequences Q6LZ30
267377.MMP0799 gi|45358362|ref|NP_987919.1| WP_011170743.1.40991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]