SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45358403|ref|NP_987960.1| from Methanococcus maripaludis S2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45358403|ref|NP_987960.1|
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily Homeodomain-like 2.46e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0038
Further Details:      
 
Domain Number 2 Region: 83-194
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000000858
Family Tetracyclin repressor-like, C-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|45358403|ref|NP_987960.1|
Sequence length 196
Comment TetR family transcriptional regulator [Methanococcus maripaludis S2]
Sequence
MDTRDQIIENSRDIFFKKGYNETSLLEIAKKCNISKGGLYHYFNKKEDLFLEVIVSMIKE
NEKIILSCIEKDIGFEEAFFEFIDKMIMIRSRYFNEYIQKDDTPTYSGPLSDAIKRFPEI
WEVNNNIYENIINGLVNRIILGQENGEIKENLDPHSIALHFCSIYEGLPLVSYYTNKKFD
ETARTIFNSFWDIIKN
Download sequence
Identical sequences Q6LYY9
267377.MMP0840 WP_011170784.1.40991 gi|45358403|ref|NP_987960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]