SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45358615|ref|NP_988172.1| from Methanococcus maripaludis S2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45358615|ref|NP_988172.1|
Domain Number 1 Region: 6-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000527
Family CAP C-terminal domain-like 0.069
Further Details:      
 
Weak hits

Sequence:  gi|45358615|ref|NP_988172.1|
Domain Number - Region: 92-123
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0222
Family NfeD domain-like 0.014
Further Details:      
 
Domain Number - Region: 107-163
Classification Level Classification E-value
Superfamily Alpha subunit of glutamate synthase, C-terminal domain 0.0536
Family Alpha subunit of glutamate synthase, C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|45358615|ref|NP_988172.1|
Sequence length 264
Comment hypothetical protein MMP1052 [Methanococcus maripaludis S2]
Sequence
MKKRNITEFQILSEVVRKQPHIKQKEIADILGITVQGVSEHMRNLIKDEQIKNKGRGEYI
ITEKGMASLKTWISNFKNYLNDVNQNLYRYKDVWPAIATEEIVPGETVGVYMKKGIIYVS
KNIESDATAKVFYGGASGEDVAIHEIHGHIEVQNGKVIVLKIPSEVMGGSRNVDYDIVQK
TLEEYPDAVIATAGTVGTVIANKLEIHPDIRFAVSEGIVSACNRGCDVIAMITGKMAEKI
IKTVDKNKISYTLLNASKTTDSIE
Download sequence
Identical sequences Q6LYD9
267377.MMP1052 gi|45358615|ref|NP_988172.1| WP_011170996.1.40991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]