SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|45358841|ref|NP_988398.1| from Methanococcus maripaludis S2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45358841|ref|NP_988398.1|
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily GlnB-like 8.89e-27
Family DUF190/COG1993 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|45358841|ref|NP_988398.1|
Sequence length 109
Comment hypothetical protein MMP1278 [Methanococcus maripaludis S2]
Sequence
MKKISAKLLRIYLKEEDKYGKELLINSIIKTLKTNGIAGATVFKGFCGYGTRGISRIDIL
RLSMNLPAVIECIDYEEKLNDIMPKLVEMVSENGLITIQDIDVFKELKK
Download sequence
Identical sequences Q6LXS0
267377.MMP1278 gi|45358841|ref|NP_988398.1| WP_011171222.1.40991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]