SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000001253 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000001253
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000001253   Gene: ENSMUSG00000020651   Transcript: ENSMUST00000001253
Sequence length 780
Comment pep:known chromosome:GRCm38:12:31519827:31559969:-1 gene:ENSMUSG00000020651 transcript:ENSMUST00000001253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARGGRSEPPQLAEYSCSYTVSRPVYSELAFQQQRERRLPERRTLRDSLARSCSCSRKR
AFGVVKTLLPILDWLPKYRVKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVQFGLYSA
FFPILTYFVFGTSRHISVGPFPVVSLMVGSVVLSMAPDDHFLVPSGNGSALNSTTLDTGT
RDAARVLLASTLTLLVGIIQLVFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGILSIIYTLIEIFQNIGDTNIADFIAGLLTIIVCMAVKELNDRFKHRIPVPI
PIEVIVTIIATAISYGANLEKNYNAGIVKSIPSGFLPPVLPSVGLFSDMLAASFSIAVVA
YAIAVSVGKVYATKHDYVIDGNQEFIAFGISNVFSGFFSCFVATTALSRTAVQESTGGKT
QVAGLISAVIVMVAIVALGRLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWKQNKTDAV
IWVFTCIMSIILGLDLGLLAGLLFALLTVVLRVQFPSWNGLGSVPSTDIYKSITHYKNLE
EPEGVKILRFSSPIFYGNVDGFKKCINSTVGFDAIRVYNKRLKALRRIQKLIKKGQLRAT
KNGIISDIGSSNNAFEPDEDVEEPEELNIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAVSFLDVVGVRSLRMIVKEFQRIDVNVYFALLQDDVLEKMEQCGFFDDNIRKDRFFL
TVHDAILHLQNQVKSREGQDSLLETVARIRDCKDPLDLMEAEMNAEELDVQDEAMRRLAS
Download sequence
Identical sequences Q9R155
10090.ENSMUSP00000001253 NP_035997.1.92730 XP_006515154.1.92730 XP_006515155.1.92730 XP_017170557.1.92730 ENSMUSP00000001253 ENSMUSP00000001253 ENSMUSP00000001253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]