SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000001254 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000001254
Domain Number 1 Region: 521-553,635-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000011
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000001254   Gene: ENSMUSG00000001225   Transcript: ENSMUST00000001254
Sequence length 757
Comment pep:known chromosome:GRCm38:12:31438219:31473917:1 gene:ENSMUSG00000001225 transcript:ENSMUST00000001254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEAIGNQYVVARPVYSTKTFGEEFKKTHRHHKTFLDHLKGCCSCSSQKAKKIALSLFPI
ASWLPAYKIKEWLLSDIVSGISTGLVAVLQGLAFALLVNIPPAYGLYAAFFPVITYFFLG
TSRHISVGPFPVLSMMVGVVVTRVVSDPNASSELSSSSTENDSFIEEKVMVAASVTVLSG
IIQLLLGVLQVGFVVIYLSESLISGFTTAAAIHVLVSQLKFMLQLPVPAYSDPFSIFKVL
ESVFTQIQKTNIADLVTSVIILVVVFVFKEINQRYRSKLPVPIPIELIMTVIATGVSYGC
NFEDRFGVAVVGNMSLGFQPPITPSVEVFQDTIGDSFGIAIVGFAVAFSVASVYSLKYDY
PIDGNQELIALGVSNIFTGAFKGFAGSTALSRSGVQESTGGKTQVAGLLSAVIVLIVIVA
IGFLLQPLQKSVLAALALGNLKGMLMQFAEIGRLWKKDKYDCLIWIMTFIFAIVLGLGLG
LAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKNYAEVYEPEGVKIFRCPSPIYFA
NIGFFKQKLIDAVGFSPLRILRKRNKALKKIRKLQKRGLIQMTPKGFICTSDGFKDSDEE
LDNNQIEELDQPINTTDLPFDIDWNGDLPLNITIPKISLHSLILDFSAVSFLDVSSMRGL
RTILQEFIRIKVDVYIVGTDDDFIDKLARCEFFDDEVTDSIFFLTIHDAILHILMKKDYS
TSKFNSSQEKERKFDFTINTNGGLRNRECQVPVETKF
Download sequence
Identical sequences Q9WVC8
ENSMUSP00000001254 ENSMUSP00000001254 NP_067328.1.92730 XP_017170439.1.92730 ENSMUSP00000001254 10090.ENSMUSP00000001254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]