SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000005601 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000005601
Domain Number 1 Region: 118-223
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000216
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 2 Region: 316-500
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000013
Family Fibronectin type III 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000005601
Domain Number - Region: 19-59
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0385
Family Fibronectin type III 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000005601   Gene: ENSMUSG00000005465   Transcript: ENSMUST00000005601
Sequence length 623
Comment pep:known chromosome:GRCm38:8:84030287:84042575:-1 gene:ENSMUSG00000005465 transcript:ENSMUST00000005601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLRVARLTPLELLLSLMSLLLGTRPHGSPGPLQCYSVGPLGILNCSWEPLGDLETPPV
LYHQSQKYHPNRVWEVKVPSKQSWVTIPREQFTMADKLLIWGTQKGRPLWSSVSVNLETQ
MKPDTPQIFSQVDISEEATLEATVQWAPPVWPPQKVLICQFRYKECQAETWTRLEPQLKT
DGLTPVEMQNLEPGTCYQVSGRCQVENGYPWGEWSSPLSFQTPFLDPEDVWVSGTVCETS
GKRAALLVWKDPRPCVQVTYTVWFGAGDITTTQEEVPCCKSPVPAWMEWAVVSPGNSTSW
VPPTNLSLVCLAPESAPCDVGVSSADGSPGIKVTWKQGTRKPLEYVVDWAQDGDSLDKLN
WTRLPPGNLSTLLPGEFKGGVPYRITVTAVYSGGLAAAPSVWGFREELVPLAGPAVWRLP
DDPPGTPVVAWGEVPRHQLRGQATHYTFCIQSRGLSTVCRNVSSQTQTATLPNLHLGSFK
LWVTVSTVAGQGPPGPNLSLHLPDNRIRWKALPWFLSLWGLLLMGCGLSLASTRCLQARC
LHWRHKLLPQWIWERVPDPANSNSGQPYIKEVSLPQPPKDGPILEVEEVELQPVVESPKA
SAPIYSGYEKHFLPTPEELGLLV
Download sequence
Identical sequences O70394
ENSMUSP00000005601 ENSMUSP00000005601 NP_057880.2.92730 ENSMUSP00000005601 10090.ENSMUSP00000005601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]