SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000018383 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000018383
Domain Number 1 Region: 12-44
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000105
Family Retrovirus zinc finger-like domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000018383   Gene: ENSMUSG00000018239   Transcript: ENSMUST00000018383
Sequence length 178
Comment pep:known chromosome:GRCm38:11:53324679:53333301:1 gene:ENSMUSG00000018239 transcript:ENSMUST00000018383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPMHRLIARRKAEANKQHVRCQKCLEFGHWTYECKGKRKYLHRPSRTAELKKALKEKE
NRLLLQSIGETNIEKKIKKKKRSKSVTSSSTSSSDSSASESSSESETSASSSSEDSDSDE
SLSSSSSSSSSSACSSSSSSSSSSSSSDSDSSSSSSSSSSSSESSSDDEPQKKKKKKK
Download sequence
Identical sequences Q9CX48
ENSMUSP00000018383 ENSMUSP00000018383 10090.ENSMUSP00000018383 NP_080755.2.92730 ENSMUSP00000018383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]