SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020208 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020208
Domain Number 1 Region: 841-1047
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-55
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 1209-1395
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-26
Family Pleckstrin-homology domain (PH domain) 0.00000308
Further Details:      
 
Domain Number 3 Region: 1036-1156
Classification Level Classification E-value
Superfamily PH domain-like 7.8e-25
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020208   Gene: ENSMUSG00000020021   Transcript: ENSMUST00000020208
Sequence length 1399
Comment pep:known chromosome:GRCm38:10:94036001:94145339:1 gene:ENSMUSG00000020021 transcript:ENSMUST00000020208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSAAELKKPPLAPKPKLVGTNNKPPPPPIAPKPDIGSASVPRLTKKTKPAIAPKPKVPT
NSVVQDIKHPPSKKPTLNLEEREPELPESTGKSNCKDVRDPHSDYILPTCSCSSGCIHEP
RTRETQCVEQLVLEPLGMKENLENSKNGESSKRGSSWDSSSEKCRGQSGVVLKASILEEK
LKEVLTQQRSPCGSPGRHRAPKKPEMNGDHSCTRQIRIEFADVSSSLTGFEKVPAHHNCH
PQLPRDESQTLKTCQDGSAESRGHTDSCEPENKRVASDGISQKTEVKGLGPLEIHLLPYT
SKFPTPKPRKTHAAARLRRQKHVDTPGESTEEPGNSNNGSSCLLEDYCLKNNKVSVLRQN
ALYNQGPVDEVRPANQRALTGDSNSGGQDSVGSQKAVQQQTPSLDTDSSLTSDSSGSGVS
PAVDKETTYTQCSTQPLSLPKQVTSACTDQPPATCNPEVSAPPIQKESSSSRIIPKKPQR
HSLPAAGVLKKAASEELVEKSSSGKETNVEKGLHRNYLHHPGPPNHGASASPFDMPNPTS
EKPVWKLPHPILPFSGSPEALKRVTLSLNNEPSVSLTKPRAKSLSAVDADRCNKPCKDPP
KKTSFKKLINVKLSIGFIKSDFQKIRSKSCQHGDVSAGHPLAREPKGLESDWQGLATGEE
KRSKPTKAHSAENCSLESQKVKSWGQSSAVNGQRAESLDDRILSRHTSCTGDFGPEYENV
RHYEEIPEYENLPFVMAGRNTPDLGWQNSSSVEDTDASLYEVEEPYNAPDGQLQLDPRHQ
PCSSGTSQEGKDALHLGLSDLPSDEEVINSSDEDDVSSESSKGEPDPLEDKQDEDAGMKS
KVHHIAKEIMSSEKVFVDVLKLLHIDFRGAVAHASRQLGKPVIEDRILNQILYYLPQLYE
LNRDLLKELEERMLTWTEQQRIADIFVKKGPYLKMYSTYIKEFDKNVALLDEQCKKNPGF
AAVVREFEMSPRCANLALKHYLLKPVQRIPQYRLLLTDYLKNLLEDSVDHRDTQDALAVV
IEVANHANDTMKQGDNFQKLMQIQYSLSGHHEIVQPGRVFLKEGTLMKLSRKVMQPRMFF
LFNDALLYTTPMQSGMYKLNNMLSLAGMKVRKPTQEAYQNELKIESVERSFILSASSAAE
RDDWLEAISSSIEEYAKKRITFCPSRSLDEDSERKEEVSPLGAKAPIWIPDTRATMCMIC
TSEFTLTWRRHHCRACGKIVCQACSSNKYGLDYLKGQLARVCEHCFQELQKLDHQLSPRV
GSPGNHKSPSSALSSVLHSIPSGRKQKKIPAALKEVSANTEDSTMSGYLYRSKGSKKPWK
HLWFVIKNKVLYTYAASEDVAALESQPLLGFTVTLVKDENSESKVFQLLHKGMVFYVFKA
DDAHSTQRWIDAFQEGTVL
Download sequence
Identical sequences Q69ZL1
ENSMUSP00000020208 ENSMUSP00000020208 NP_444302.4.92730 10090.ENSMUSP00000020208 ENSMUSP00000020208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]