SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028004 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028004
Domain Number 1 Region: 29-514
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-169
Family ALDH-like 0.00000000000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028004   Gene: ENSMUSG00000026687   Transcript: ENSMUST00000028004
Sequence length 518
Comment pep:known chromosome:GRCm38:1:167349991:167368530:1 gene:ENSMUSG00000026687 transcript:ENSMUST00000028004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILGAVGSVLTSLLRIHRAAAVAAMSTGTFVVSQPLNYRGGARVEPVDASGTEKAFEPAT
GRVIATFACSGEKEVNLAVENAKAAFKLWSKKSGLERCQVLLEAARIIKERKDEIATVET
INNGKSIFEARLDVDTCWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIACWKSAPALACGNAMIFKPSPFTPVSALLLAEIYTKAGAPPGLFNVVQGGAATG
QFLCHHREVAKISFTGSVPTGVKIMEMSAKGVKPITLELGGKSPLIIFSDCNMENAVKGA
LMANFLTQGQVCCNGTRVFVQKEIADKFINEVVKQTQKIKLGDPLLEDTRMGPLINAPHL
ERVLGFVKLAKEQGATVLCGGEVYVPEDPKLKHGYYMTPCILTNCRDDMTCVKEEIFGPV
MSILTFGTEAEVLERANDTTFGLAAGVFTRDIQRAHRVAAELQAGTCYINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
Download sequence
Identical sequences Q3U367
ENSMUSP00000028004 ENSMUSP00000028004 10090.ENSMUSP00000028004 NP_064377.2.92730 ENSMUSP00000028004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]