SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036257 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036257
Domain Number 1 Region: 938-1034
Classification Level Classification E-value
Superfamily Fibronectin type III 7.92e-18
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 111-213
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000171
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036257   Gene: ENSMUSG00000035258   Transcript: ENSMUST00000048471
Sequence length 1179
Comment pep:known chromosome:GRCm38:16:56477846:56690128:1 gene:ENSMUSG00000035258 transcript:ENSMUST00000048471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSLGCLLLCGSIALALGNAQKLPKGKKPSLKVHINTTSDSILLKFLRPNANVKLEGFL
LGYGSNVSPNQYFPLPTEGKFTEAVVDAEPKYLIVVRPAPPPSQKKSCSGKSRPRKPLQL
VVGTLTPSSVFLSWGFLINPHHDWTLPSHCPSDRFYTIRYREKDKEKKWIFQLCPATETI
VENLKPNTVYEFGVKDNIEGGIWSKIFNHKTIVGSKNKVNGKIQSTYDQVHSVPVPRKLI
PLTIIKQVIQNVTHRASTKSPDKTPFGGTILVHLIIPGLNESTVKLPTSIMLEISDALKA
QLAKNETLALPAESKTPEVEKLAGQPVTVTPESVSRSTKPTLSSALDTAETALVLSEKTS
ETARSVLIPEFELPLSTLAPKRFPEFPEAKTAFPLEKPRGSWASSEEPWVVPGAKTSEDS
RVVQPQTATYDVISSSTTSDETEIEIHTATRDPILDSVPPKTSRTAEQPRATLAPIEALF
ESRNVEIFTSPEVRPTTAAPQQTTSIPSTPKRQSTPKPPRVKPAPEPETRPSAQTTKAPR
KTKKPGHHRLRRPKTTRSPEVPKSKPALEPATVTPEILVPKIVPKPPQKPKATRRPEVPQ
VKPAPRQTTSMPPKLKTPHSRMPAKEPVPKEPLHTTSKPKMPPSPEVADTTSVPKDERLS
LKPDPEVTHSETAPLETRGIPLIPVISPRPSQEELQTAMEETDQSTQELFTTKIPRTTEL
AKTTQAPHRLHTAPVRPRIPGRPHGRPALNKTTTRPDKTKPRGTSHKNGVGTGTKQAPKP
PSPGRNASVDSHATRKPGSVSGTRRPPIPHRHSSTRPVSPERRPLPPNNVTGKPGRAGIV
SSSRVTSPPLKATLHPIGTATARPGAEQKEPTAPASEEEFGTTTDFSSSPTKETDPLGKP
RFIGPHVRYIPKPENKPCSITDSVRRFPTEEATEGNATSPPQNPPTNLTVVTVEGCPSFV
ILDWEKPLNDTVTEYEVISRENGSFSGKNKSIQITNQTFSTVENLKPDTSYEFQVKPKNP
LGEGPASNTVAFSTESADPRVSEPISAGRDAIWTERPFNSDSYSECKGKQYVKRTWYKKF
VGVQLCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFLDGRTGQQLTSEQLPTK
EGYFRAVRQEPVQFGEIGGHTQINYVQWYECGTTIPGKW
Download sequence
Identical sequences Q59IW6
NP_001014423.1.92730 10090.ENSMUSP00000036257 ENSMUSP00000036257 ENSMUSP00000036257 ENSMUSP00000036257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]