SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000086748 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000086748
Domain Number 1 Region: 930-1150
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-36
Family DBL homology domain (DH-domain) 0.0022
Further Details:      
 
Domain Number 2 Region: 1311-1512
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-32
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 1141-1258
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-24
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000086748   Gene: ENSMUSG00000034037   Transcript: ENSMUST00000089334
Sequence length 1514
Comment pep:known chromosome:GRCm38:6:91978878:92076004:1 gene:ENSMUSG00000034037 transcript:ENSMUST00000089334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRADSPKPPLAPKPKVATNPYAPAAKFPPSQRPDSFPSPNSMSRGPKPPIAPKPRLTGP
SEYLNNSLGKCSNGRLLCEDRGLYDGHHSTLNCLELEPDEQYIMVPRAPQKEDTPVDGAT
EEPGFEGEVQEHGTEQTGTEGDLEAPDEEAPSRDSEEGMVHALEDEDCDHDPETDGTPTS
PDEGAPSRDSEEGEEDCDQGPGMEEHPMSEEEGEEEEVKEHVYNSDNRAPWDGEEPFPNE
VILTHVRSQSPEVPCWEPGPPETPGEAEEDCEDICNNTEPGKPNQDTGQDTEDAGMGSPE
SEVSPDVQEQEAATDNPEVFEEDSADAAEGEDQIEQEEPPNCDEEAYNRDAAAATMQVGE
DLGEEGDHVQEDPAEESCQIIPFESDSVEEDFSPTLTENPYEIFPTESTSFCNNTYSLDE
SANGHEPVCEICVEEVPGVGPPLNQHDSLPDGSGEDSPVVPDVVVVPENEGPVDDALSSP
YVMGVGLLSLGEGAQSDTQAASGTLSGYSTWEEGDSEGGQVPVDRKNIATRARPHSGKVA
GHVPETVLEETGPETCSSGMGIRDTSDEVRKIGILPEGKPPECVRALPAKPRAFTLYPRS
FSVEGRESPLSMFREPEGAGLDSHRVRRKEDNLSLPGAIGSSGSFSQRSHLPSSGTSTPS
SVVDIPPPFDLACITKKPITKSSPSLLIDGDTLEKASKKKKSSFKRFLELTFRKKTESKV
HVDMNLSSSRSSSESSYHGPARVLELDRRSLSNSPQLKCRTGKLRASDSPAALIFYRDSK
RKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIPAMNSDYENIQI
PPRRPVRTGTFTKLFEEQSRALSTANENDGYVDMSSFNAFESKQQSSEQEAESAYTEPYK
VCPISAAPREDLTSDEEQGSSEEEDSASRDPSLSHKGEGQSRALVIAQELLSSEKAYVQM
LQHLSLDFHGAVLRALENVEQEGREPLAQEELRQGLRELPAICDLHQGILESLEQRLGDC
GEGQPQVADIFLAQEQEFEHHAAHILQFDRYLGLLAESCLLSPRLATTVREFEQSSQGGG
QSMKHRMLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQSALTLISKVTDRANESMEQGE
NLQKLVHIEYSVRGQGDLLQPGREFLKEGTLMRVRGKSRHPRHLFLMNDTLLYTHPQKDG
KYRLKSSLPVANMKVSRPVMDKVPYALKIETPESCLTLSASSCAERDEWHYCLSRALPED
YKTQALAAFHHSVEIRERLGISLGERLPTLVPVTHAMMCMNCGCDFSLTVRRHHCHACGK
IVCRNCSRNKYPLKCLKNRMAKVCDGCFRELKLRNGPVPGSMRERPVSMSFPLSSSRFSS
GSALSSVFQSISPSTFKKQKKVPSALSEVAASGEGSAISGYLSRCKSGKRRWKKLWLVIK
GKVLYTYLASEDKVAMESIPLLGFTIAPEKEEGSSEVGPVFHLYHKKTLFYSFKAEDSNS
AQRWMEAMEDASVL
Download sequence
Identical sequences E9QKY4
ENSMUSP00000086748 10090.ENSMUSP00000086748 NP_766319.3.92730 ENSMUSP00000086748 ENSMUSP00000086748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]