SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097013 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097013
Domain Number 1 Region: 16-150
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.18e-22
Family L-arabinose binding protein-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097013   Gene: ENSMUSG00000094499   Transcript: ENSMUST00000099416
Sequence length 223
Comment pep:known chromosome:GRCm38:13:66352469:66355385:-1 gene:ENSMUSG00000094499 transcript:ENSMUST00000099416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQLKEISTLISSWDCHFCTPQSTSEWTALHKCDMALSEDCYSLYKAVYVVVHTYHELM
LQQVESQKIAEPKRLFTDCQQMVSLLKAQVFTNPDGELVNMNHREYQCVEYDICIIWNFR
QGLGLKVKIGSYFPCFPQTQQLLISEDLEWATGGTSVPFSMCSVACTAGFRKIHQEETAD
CCFDCVQCPENEVSNETGTCLHAEEKLLNLNVFSFQTRNIWSR
Download sequence
Identical sequences ENSMUSP00000097013 ENSMUSP00000097013 ENSMUSP00000097013 10090.ENSMUSP00000097013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]