SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|84488934|ref|YP_447166.1| from Methanosphaera stadtmanae DSM 3091

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|84488934|ref|YP_447166.1|
Domain Number 1 Region: 2-176
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.69e-17
Family GHMP Kinase, N-terminal domain 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|84488934|ref|YP_447166.1|
Domain Number - Region: 188-296
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000791
Family Homoserine kinase 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|84488934|ref|YP_447166.1|
Sequence length 305
Comment hypothetical protein Msp_0104 [Methanosphaera stadtmanae DSM 3091]
Sequence
MVKVRSPASATVINAISMGKGSAFGIKLYVTSDVRVLNHDAKEDIECKCKSLDYPDMDTS
LMDLCVKKVYYKLREFDIFNLKNITLKVETKSDIPPGSGLSSSSAASNSIVYATLMELLS
EANLSRDDVDITDEDLLNMGIDASLEVGVTKTGSYDDASASFYGGWKITDNYERKILHDY
IVDYQKVLIYIPNKSLYTAQSDVKAMKTLAPLVEMAFENAIKKNIEKALTLNGFLFCAAL
NLDSQISIDALKSGAKAAGLSGTGSAYSILVDDLSDIDEIKSALSKYEGKLVETSPDNKG
SVVIG
Download sequence
Identical sequences Q2NHX0
gi|84488934|ref|YP_447166.1| 339860.Msp_0104 WP_011405722.1.14142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]