SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|84489658|ref|YP_447890.1| from Methanosphaera stadtmanae DSM 3091

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|84489658|ref|YP_447890.1|
Domain Number 1 Region: 3-194
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.75e-36
Family GHMP Kinase, N-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 179-315
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.06e-31
Family Mevalonate kinase 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|84489658|ref|YP_447890.1|
Sequence length 322
Comment mevalonate kinase [Methanosphaera stadtmanae DSM 3091]
Sequence
MKIKAFAPGKIILFGEHTVVYKKPAIAVAIDRGVNVELIPRNDDNITVKLDLIDYYKKSQ
LVNKKLNYKIDSQKKMITDYIYEVINLFEFEKGFDLTVDIKMYLGAGLGSSAAVTVSTLK
AVSLYVNKQIDKKTIAQTAREIEIKIQGAASPIDTSMSTYGGIIFIDENSKLNRIDFNMK
LPLIVSNCEISGNTGKLVESVRLKYEKYPTIVGNIFKAMEQIAIDAKVALEKGNSELIGD
LMNINQGLLDAIGVNTTELSDMVYKAREYGAKGSKLTGSGGGGCIIAYTPENSDEIYKQL
RKDYATFKCVQSDTGVSAEIIN
Download sequence
Identical sequences A0A1D2W837 Q2NG06
WP_011406446.1.14142 WP_011406446.1.32456 339860.Msp_0858 gi|84489658|ref|YP_447890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]