SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83313188|ref|YP_423452.1| from Magnetospirillum magneticum AMB-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83313188|ref|YP_423452.1|
Domain Number 1 Region: 12-274
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.98e-109
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000000383
Further Details:      
 
Domain Number 2 Region: 438-628
Classification Level Classification E-value
Superfamily Cytochrome c 4.17e-63
Family Cytochrome bc1 domain 0.00000612
Further Details:      
 
Domain Number 3 Region: 275-397
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 2.16e-38
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000462
Further Details:      
 
Domain Number 4 Region: 629-661
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.000034
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83313188|ref|YP_423452.1|
Sequence length 664
Comment cytochrome b/c1 [Magnetospirillum magneticum AMB-1]
Sequence
MSDFKSNNKVVNWIESRLPIFSMMQHSAIDYPTPRNLNYWWNFGSLAAVMLIIMILTGLF
LAMNYSSHTSLAFDSVERIMRDVNYGWLLRYLHANGASMFFILVYIHIFRGLYYGSYKAP
REILWFVGIAIYLAMMATGFMGYVLPWGQMSFWGATVITNLFSAFPVVGEFIVTLLWGGF
SVDNPTLNRFFALHFLLPFIIVGLVVVHVWALHSVKSNNPLGIDMKGPQDSIPFHPFYTI
KDLYGIGLFLMFYLAFVFWAPNFFGEPDNYIPANPMVTPPHIVPEWYYLPFYAILRAFTF
DLPFLPAKLQGVLAMFSAILILFALPWLDTSKVRSAKFRPLYRQFFWLFFANAMILGYVG
GKPAEGILVKIGQFCTAYYFAHFLLILPILGKIEKPKALPASIAQPVVKAAALIAMIMVG
LAGFGGEAQASSAGPELKKPAVAFSWEGFFGKHDKAALKRGWQVFHDVCSNCHSMKLVAY
RSLTDIGFTADEVKAFAAEKEVPDQPNDEGVVANRPARPSDKIVPPFANDKAAAAANGGA
LPPDLSLMNKARTNGPYYVYSLMLGYEEAAPEGHPIPEGKYFNHYFPGNAISMPAPIMDD
IVAYADGTKATKEQVAYDVVTFLNWAAEPELDARKSMGVKVMVFLALLTAMLYALKRQIW
KDVH
Download sequence
Identical sequences Q2VZT2
342108.amb4089 gi|83313188|ref|YP_423452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]