SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|409246939|ref|YP_006887641.1| from Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|409246939|ref|YP_006887641.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.02e-112
Family FMN-linked oxidoreductases 0.0000000000437
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000929
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.25e-27
Family C-terminal domain of adrenodoxin reductase-like 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|409246939|ref|YP_006887641.1|
Sequence length 672
Comment putative NADPH dehydrogenase [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYANRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
ALTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A1X2ULI7 A0A267S6T9
WP_000121517.1.101126 WP_000121517.1.101454 WP_000121517.1.101473 WP_000121517.1.101636 WP_000121517.1.101639 WP_000121517.1.101975 WP_000121517.1.10711 WP_000121517.1.11213 WP_000121517.1.11964 WP_000121517.1.12396 WP_000121517.1.12701 WP_000121517.1.13101 WP_000121517.1.14050 WP_000121517.1.14056 WP_000121517.1.14876 WP_000121517.1.15627 WP_000121517.1.16551 WP_000121517.1.16855 WP_000121517.1.1757 WP_000121517.1.1825 WP_000121517.1.18485 WP_000121517.1.1968 WP_000121517.1.19740 WP_000121517.1.20415 WP_000121517.1.20488 WP_000121517.1.20862 WP_000121517.1.20900 WP_000121517.1.2146 WP_000121517.1.23529 WP_000121517.1.23646 WP_000121517.1.23755 WP_000121517.1.24995 WP_000121517.1.25928 WP_000121517.1.26512 WP_000121517.1.26882 WP_000121517.1.27072 WP_000121517.1.27713 WP_000121517.1.28948 WP_000121517.1.29099 WP_000121517.1.29255 WP_000121517.1.29349 WP_000121517.1.3068 WP_000121517.1.3114 WP_000121517.1.31665 WP_000121517.1.31952 WP_000121517.1.32491 WP_000121517.1.33106 WP_000121517.1.33986 WP_000121517.1.34458 WP_000121517.1.34659 WP_000121517.1.34854 WP_000121517.1.34972 WP_000121517.1.35868 WP_000121517.1.37478 WP_000121517.1.37521 WP_000121517.1.39609 WP_000121517.1.40229 WP_000121517.1.40258 WP_000121517.1.41735 WP_000121517.1.41877 WP_000121517.1.41938 WP_000121517.1.43276 WP_000121517.1.43441 WP_000121517.1.449 WP_000121517.1.4540 WP_000121517.1.45462 WP_000121517.1.45781 WP_000121517.1.46205 WP_000121517.1.46323 WP_000121517.1.46572 WP_000121517.1.47389 WP_000121517.1.47506 WP_000121517.1.4770 WP_000121517.1.48855 WP_000121517.1.49012 WP_000121517.1.49848 WP_000121517.1.50198 WP_000121517.1.50251 WP_000121517.1.52744 WP_000121517.1.54522 WP_000121517.1.5456 WP_000121517.1.54814 WP_000121517.1.54845 WP_000121517.1.54992 WP_000121517.1.55073 WP_000121517.1.55557 WP_000121517.1.56026 WP_000121517.1.56647 WP_000121517.1.57000 WP_000121517.1.58451 WP_000121517.1.60209 WP_000121517.1.60330 WP_000121517.1.60990 WP_000121517.1.61184 WP_000121517.1.62271 WP_000121517.1.62339 WP_000121517.1.62344 WP_000121517.1.62725 WP_000121517.1.63129 WP_000121517.1.63186 WP_000121517.1.6367 WP_000121517.1.63864 WP_000121517.1.6399 WP_000121517.1.64690 WP_000121517.1.64798 WP_000121517.1.6561 WP_000121517.1.65849 WP_000121517.1.67 WP_000121517.1.67772 WP_000121517.1.67803 WP_000121517.1.67827 WP_000121517.1.6809 WP_000121517.1.69808 WP_000121517.1.69848 WP_000121517.1.69975 WP_000121517.1.7142 WP_000121517.1.71746 WP_000121517.1.71941 WP_000121517.1.72642 WP_000121517.1.74040 WP_000121517.1.74661 WP_000121517.1.74806 WP_000121517.1.75009 WP_000121517.1.75609 WP_000121517.1.76156 WP_000121517.1.76548 WP_000121517.1.76576 WP_000121517.1.77390 WP_000121517.1.77596 WP_000121517.1.78301 WP_000121517.1.78738 WP_000121517.1.78771 WP_000121517.1.79011 WP_000121517.1.79934 WP_000121517.1.80307 WP_000121517.1.80651 WP_000121517.1.81504 WP_000121517.1.81995 WP_000121517.1.82269 WP_000121517.1.82946 WP_000121517.1.83378 WP_000121517.1.83510 WP_000121517.1.84168 WP_000121517.1.84461 WP_000121517.1.84745 WP_000121517.1.849 WP_000121517.1.85675 WP_000121517.1.86007 WP_000121517.1.88174 WP_000121517.1.88222 WP_000121517.1.88423 WP_000121517.1.88995 WP_000121517.1.89054 WP_000121517.1.89188 WP_000121517.1.89215 WP_000121517.1.90033 WP_000121517.1.90311 WP_000121517.1.91334 WP_000121517.1.91459 WP_000121517.1.91625 WP_000121517.1.92213 WP_000121517.1.92411 WP_000121517.1.92575 WP_000121517.1.92879 WP_000121517.1.95152 WP_000121517.1.95404 WP_000121517.1.95701 WP_000121517.1.95826 WP_000121517.1.96429 WP_000121517.1.96890 WP_000121517.1.97089 WP_000121517.1.97368 WP_000121517.1.97386 WP_000121517.1.97413 WP_000121517.1.98107 WP_000121517.1.98201 WP_000121517.1.99197 WP_000121517.1.99339 gi|409246939|ref|YP_006887641.1| ABFF01000005|CDS_118017-115999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]