SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88601355|ref|YP_501533.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|88601355|ref|YP_501533.1|
Domain Number - Region: 42-66,93-167
Classification Level Classification E-value
Superfamily TPR-like 0.000304
Family Transcription factor MalT domain III 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88601355|ref|YP_501533.1|
Sequence length 176
Comment hypothetical protein Mhun_0036 [Methanospirillum hungatei JF-1]
Sequence
MSFQDFVPDVWYMIAGRIAPPLCCTRPAPVHQVFKKALFEVFKKEGDIDEAVRLLQDILL
HAPPEWMVFDQAGQLLNVIGWRNSYHKDWFEPDRKVHSFKPGRCGPHVAHAYALMQAAVD
DEALGLVSRIISEGEQDSDDVHMARLIRASICICQGRIEEGEEELRMLSSSEKYYS
Download sequence
Identical sequences Q2FQD9
323259.Mhun_0036 WP_011447111.1.85653 gi|88601355|ref|YP_501533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]