SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88601356|ref|YP_501534.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601356|ref|YP_501534.1|
Domain Number 1 Region: 13-235
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 2.35e-50
Family NIF3 (NGG1p interacting factor 3)-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88601356|ref|YP_501534.1|
Sequence length 245
Comment hypothetical protein Mhun_0037 [Methanospirillum hungatei JF-1]
Sequence
MTYDPHSKSGTSRQEILDLLAGLAPPELAESFDSGRIGLIIEGKEHITKISTCLDVTPAV
VRKAIENRSDLLIAHHTPIWAPLTSIGGDDARLFSMILQSEMNVYVMHTNWDHAPGGVND
ILADLLGLTERENMSLGLVGTCVRTVEEMVRILKAPLRIWGNVEKVQRLAIAAGSGFDSA
LIREAQSLGADAFLSAELRHSVYRSSPLPLLESTHYALESPAMRVLAEKHGWEYIDDLPV
LHSLS
Download sequence
Identical sequences Q2FQD8
gi|88601356|ref|YP_501534.1| 323259.Mhun_0037 WP_011447112.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]