SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88601407|ref|YP_501585.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601407|ref|YP_501585.1|
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily Ribosomal protein L16p/L10e 7.59e-58
Family Ribosomal protein L10e 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88601407|ref|YP_501585.1|
Sequence length 170
Comment 50S ribosomal protein L10 [Methanospirillum hungatei JF-1]
Sequence
MVRKPNSMYRNLAKKAYTRKEYMGGIPGVKVVHFDMGNLTSEFPMEVSLVVDESCQIRHS
ALEAARMSINRKLNKELGRMNYHLKLRTYPHHVLRENKQATGAGADRVSQGMRLAFGKAV
GTAARCQQNQKIFTVFSNPASVEKIKDALRHGGHKLPSPTHLVIEMKQES
Download sequence
Identical sequences Q2FLD3
323259.Mhun_0088 WP_011447162.1.85653 gi|88601407|ref|YP_501585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]