SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88601434|ref|YP_501612.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601434|ref|YP_501612.1|
Domain Number 1 Region: 658-917
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.27e-103
Family BC ATP-binding domain-like 0.000000283
Further Details:      
 
Domain Number 2 Region: 126-396
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.64e-103
Family BC ATP-binding domain-like 0.000000155
Further Details:      
 
Domain Number 3 Region: 534-657
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.12e-43
Family BC N-terminal domain-like 0.000011
Further Details:      
 
Domain Number 4 Region: 1-123
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.73e-42
Family BC N-terminal domain-like 0.0000105
Further Details:      
 
Domain Number 5 Region: 392-527
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 1.01e-38
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00049
Further Details:      
 
Domain Number 6 Region: 921-1054
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.35e-33
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88601434|ref|YP_501612.1|
Sequence length 1056
Comment carbamoyl phosphate synthase large subunit [Methanospirillum hungatei JF-1]
Sequence
MPRDPSIKKVLLIGSGPIQIGQAAEFDFSGSQACRALREEGVSVVLVNSNPATIQTDPDM
ADVTYVEPLQADIIAKIIKKEKPDGILSGMGGQTGLNLTAELAEMGALEGVKILGTPLKA
IYEGEDREKFRDLMNRIGEPVPRSVIVSSLDQLEHAASVVGFPAIIRPAYTLGGAGGGIA
YNLDELRRIVELGLGKSRIHQVLIEESVAGWKEIEFEVMRDANDTCITICGMENVDPMGV
HTGESVVVAPILTLRDDEFHLLRNAALKIIRALDVQGGCNIQFAFKGDDEYRVIEVNPRV
SRSSALASKATGYPIARVASKIAIGLRLDEILNTVTGKTPASFEPSIDYVVVKVPRWPFD
KFKTADRTLTTAMKSTGEVMAIGRCVEEAFLKALRSLDTDVEHHTVLSELKMILSRPTDE
RFGALFDALRQGMTLNEIAEITRITPFWLEKIQNIVEMEKALTAHPDDATILKAKEFGFS
DLEIAQYSGKDVSEVESKVGLPVYKMVDTCAAEFPAQTPYFYSTYGDKVCEVTHSDRKKV
MILGSGPIRIGQGIEFDYCTVHAVTALREDGYEVHVVNNNPETVSTDFDTSDRLFFEPMT
LEDVSHILQKDDYYGVMVQFGGQNAVNLAVPLKNEIDRLNLKTRILGTTPDAMDMAEDRD
RFSVLLDSLSIPTPPNGSAYSEQEAYATAERIGYPVLVRPSYVLGGRAMEIVHDDTELAT
YMREAVRVSKSHPVLIDRFLQNAIELDVDAVCDGTDVIIGGIMEHIETAGVHSGDSACVI
PPQSLSPEILADVRDYTRKIALGLGVVGLVNIQFAVQGSTVYVLEANPRASRTVPFVAKS
VGIPLAKIAARVMMGERLADMPYKEIEVSHVAVKEVLLPFNKLPGVDTVLGPEMKSTGEV
MGIDYDFGRAYYKASIAAHNRLPKSGNVFISVTDDLKDQILQVAKTFTENGLSIYATSGT
VEFFAERGITANLVRKIAEGSPNVLDMLRAGEISLIINNFADKQSRHDHQQIMRVAVDYG
TPYITTLQAAVAAAEAINSVREENLTIEPLQHYIGR
Download sequence
Identical sequences Q2FLD9
gi|88601434|ref|YP_501612.1| 323259.Mhun_0115 WP_011447189.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]