SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88601687|ref|YP_501865.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601687|ref|YP_501865.1|
Domain Number 1 Region: 7-115
Classification Level Classification E-value
Superfamily PIN domain-like 0.0000000000304
Family PIN domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88601687|ref|YP_501865.1|
Sequence length 147
Comment hypothetical protein Mhun_0381 [Methanospirillum hungatei JF-1]
Sequence
MTECESVFDTSALVKIFHNEEGSERTRELILNAQNNLYILDIAQIEYFSAIFRRYRNHEL
SKKSLNIAISGFEKEMSHYCIEPTTPLVIKEAQKLIFSYGDKFGLRTLDSLHLAAFSLIS
NDDWIFVCCDSILSCVAEEYPFTVPLI
Download sequence
Identical sequences Q2FN24
323259.Mhun_0381 gi|88601687|ref|YP_501865.1| WP_011447440.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]