SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88601944|ref|YP_502122.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601944|ref|YP_502122.1|
Domain Number 1 Region: 234-393
Classification Level Classification E-value
Superfamily RraA-like 1.15e-44
Family RraA-like 0.00075
Further Details:      
 
Domain Number 2 Region: 1-212
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.97e-40
Family Decarboxylase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88601944|ref|YP_502122.1|
Sequence length 429
Comment bifunctional hexulose-6-phosphate synthase/ribonuclease regulator [Methanospirillum hungatei JF-1]
Sequence
MNRSVLQVALDLVELDRAITIAGEAVLGGADWLEVGTPLIKSEGMRAVSALKSAFPDRQI
IADMKTADTGAIEVEMAAKSGADIVCVLGASDNSVIAESVRAARKYGVKIMADLISVPNP
SGRAGELEQLGVDYICAHTGIDQQMTGTDSLDLLMKVIREVSIPVAAAGGISEKTAPGAI
AAGASIVIVGGSIIRSSDVTGSTRRIKEAMNQPVPYAGPDISQEDEIREILRYVSSSNVS
DAMHRKGAMSGMIPLCPGTKAVGKAVTVQTFAGDWAKPVEAIDIALPGDVIVINNDKGTH
VAPWGELATISCLNRGISGVIIDGAVRDVDDIKKMQYPLWSTAMVPNAGEPKGFGEIGSE
IQCGGQTVNPGDWIIADESGVVVIPKTRAYEIARRAKEVYNTELRIRQELKQGKTLSQVM
NLLRWEKHS
Download sequence
Identical sequences Q2FLC4
WP_011447687.1.85653 gi|88601944|ref|YP_502122.1| 323259.Mhun_0647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]