SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602067|ref|YP_502245.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602067|ref|YP_502245.1|
Domain Number 1 Region: 283-506
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 8.89e-49
Family Protein prenylyltransferase 0.007
Further Details:      
 
Domain Number 2 Region: 170-338
Classification Level Classification E-value
Superfamily TPR-like 1.52e-28
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 3 Region: 70-202
Classification Level Classification E-value
Superfamily TPR-like 5.31e-20
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88602067|ref|YP_502245.1|
Sequence length 519
Comment tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
Sequence
MDQDMPSDNTIDRITSDSLNLFGSEVIIQEVTEEPEIPDDQALIQEESDEIQFKEEPDLQ
ENSESASHPYLAIGIQLIRDHEWIKALPYLSKVIDSDEEAPLGWLYLGMIHLHLSNFEQA
REYLQKAFSFERTRSISLYYLAFGEYRQSDFQKALTYLEQIPAGDIKNEKKLFLKGLCHF
KLRQYQSAIQEFHELLISDPDHKRTLFLIAYSQLLSNFPEEALKNVDHLLELDDRFVHAW
ELKSRILIKLERYSEALSSTKRLLWLKPKAYAGLWISCFSLLKMNRYEEALNTSRLITTY
YPLHSTGWNLMGLAYMGLNKFQDALKPLERALQINPHDSASQAYRIIALRKLKRYGDLLQ
YYEYLTEEEPDNLKAWFNRGVLLHRAGRFLEAIESYQKVLNKNPADSRALLNKGRAHQAL
HETHKAITLFKQVIHIHPENSDAWFYLGQIYTNLVRLAEAIVCFDQVLRIDPRHVKAMIY
KAKILNELGKKQQAYQMVHKAKSLDPDITNQMAGSLVHD
Download sequence
Identical sequences Q2FQT0
323259.Mhun_0774 WP_011447805.1.85653 gi|88602067|ref|YP_502245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]