SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602084|ref|YP_502262.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602084|ref|YP_502262.1|
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.000000000334
Family Prokaryotic type KH domain (KH-domain type II) 0.0068
Further Details:      
 
Domain Number 2 Region: 75-129
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.000000206
Family Prokaryotic type KH domain (KH-domain type II) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88602084|ref|YP_502262.1|
Sequence length 147
Comment NusA family protein [Methanospirillum hungatei JF-1]
Sequence
MERNLGFKERRYIEELRILTKSTALDCLIDDKFDRIIYVIKAGDMGYAIGKKGDNIRRLQ
GVTGRKVEMVEYAEDLQEFLSNIFKPAQVIRFACDDQTKKMNIYVSDKNDVGIAIGKGGC
TIEKARILIRRFHGYEIGEVFPEESAA
Download sequence
Identical sequences Q2FUB8
gi|88602084|ref|YP_502262.1| 323259.Mhun_0791 WP_011447822.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]